PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim02g085160.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ZF-HD
Protein Properties Length: 294aa    MW: 33312.9 Da    PI: 8.1131
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim02g085160.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer103.41.5e-3290145460
         ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                         vrYkeClkNhAa+lGg+++DGCgEfmps gee t + lkCaAC+CHRnFHR+e+e+e
  Sopim02g085160.0.1  90 VRYKECLKNHAANLGGYVLDGCGEFMPS-GEEETLEYLKCAACDCHRNFHRKETEDE 145
                         89*************************9.8888********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257748.0E-2190143IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047703.1E-3090142IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.5E-2991141IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.20692141IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.602.7E-29224291IPR009057Homeodomain-like
SuperFamilySSF466891.32E-18225290IPR009057Homeodomain-like
TIGRFAMsTIGR015653.3E-26229286IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MEHRGQEKDM GLPNPNPMSY NPSQLNQQES SSSAANKFLT APNRTTNEHE NTIFSPNQTL  60
DQHNITQNSD PDPVRQLSTS SASERNITPV RYKECLKNHA ANLGGYVLDG CGEFMPSGEE  120
ETLEYLKCAA CDCHRNFHRK ETEDESQTPG VHRNNHRIPN QTPPSLPAVP TQQQHHHKYP  180
HSYPRGHMAP VMMSFGGNTG VAAESSSEDL NMFHGGQGVI QPCNFSASKK RFRTKFSQQQ  240
KDRMLEFAEK LGWRIQKQDE QEVHQFCNEV GVKRQVFKVW MHNSKQATKK KQN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-222282851673ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2153630.0AC215363.2 Solanum lycopersicum cultivar Heinz 1706 chromosome 2 clone C02HBa0030A21, complete sequence.
GenBankAC2153780.0AC215378.2 Solanum lycopersicum cultivar Heinz 1706 chromosome 2 clone C02HBa0074A14, complete sequence.
GenBankHG9755140.0HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004232414.10.0PREDICTED: zinc-finger homeodomain protein 5
SwissprotQ9ZPW78e-68ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLK4BB300.0K4BB30_SOLLC; Uncharacterized protein
STRINGSolyc02g085160.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.15e-69homeobox protein 24